PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G396114_P01
Common NameLOC100281671
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TALE
Protein Properties Length: 755aa    MW: 79167.8 Da    PI: 6.9865
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G396114_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-095656021954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  GRMZM2G396114_P01 565 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 602
                        564459******************************88 PP

2BELL118.72.7e-38426496272
               BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        r e q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  GRMZM2G396114_P01 426 RFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 496
                        6799****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.9E-70348494IPR006563POX domain
PfamPF075267.3E-53353493IPR006563POX domain
PROSITE profilePS5007112.6543606IPR001356Homeobox domain
SMARTSM003891.6E-9546610IPR001356Homeobox domain
CDDcd000864.27E-13546607No hitNo description
SuperFamilySSF466892.57E-17548613IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28549612IPR009057Homeodomain-like
PfamPF059203.8E-18563602IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MGVAAPPYET TTYVSQRTKI NIAAISAAAA TRAATAASMS HSQGFHQGSA GVYGYSSDGF  60
DRPDDSGHQD HHQQQQHVAQ QSRRDKLRVQ GFDPAAGGGH GLLPIEGDEH GGPGSMYEHA  120
AAAAGASNML SEMFNFPAPP SGPSATELLA SQMGANYRFG GLRQQQQQGP GGVVAGLSGD  180
GGWFVGAGAA GRAAGLVLGG GANMGSLGET SSPKQQGSMA GLATDPAAAM QLFLMNPQQQ  240
QQSRSSPPSP SDVQVQHHEA AFQAFGNAGA PFGGGAGTGV VEGQGLSLSL SPSLQQLEMA  300
KQAEELRVRD GVLYFNRQQQ QQQQQLPMAL HGQVGALGQQ LHVGYGPAGV AGVLRNSKYT  360
RAAQELLEEF CSVGRGQIKG GGRGASASNP NNNPGNKGGA SSSGAAAQSP SSAPNKEPPQ  420
LSPADRFEQQ RKKAKLISML DEVDRRYNHY CDQMQMVVNF FDSVMGFGAA TPYTALAQKA  480
MSRHFRCLKD AIAAQLRATC ELLGEKDAGT SSGLTKGETP RLRAIDQSLR QQRAFHHMGM  540
MEQEAWRPQR GLPERSVNIL RSWLFEHFLH PYPSDADKHL LARQTGLSRN QVSNWFINAR  600
VRLWKPMIEE MYQQECRELD GSSAGGGGPE SVNDPSGADD SHSPTTTGAA QLPQQQHHLG  660
TVPGVMPHKP DPGAAGPSAA DAAFVGIDPV ELLGGGADDL YGRFEPGVRV RYGPAAAGAA  720
AGDVSLTLGL QHAGAGNAAG PDSTGRFSLR DYSGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-17552609158Homeobox protein Meis1
4xrs_A2e-17552609158Homeobox protein Meis1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G396114
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G396114_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9575010.0EU957501.1 Zea mays clone 1595427 homeodomain protein JUBEL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148063.10.0homeodomain protein JUBEL1
SwissprotQ94KL51e-140BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A096TKA70.0A0A096TKA7_MAIZE; Uncharacterized protein
STRINGGRMZM2G396114_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-125BEL1-like homeodomain 4